Allergen Bla g 4, Recombinant, Blattella Germanica, aa13-182, His-SUMO-Tag

Artikelnummer: USB-370510
Artikelname: Allergen Bla g 4, Recombinant, Blattella Germanica, aa13-182, His-SUMO-Tag
Artikelnummer: USB-370510
Hersteller Artikelnummer: 370510
Alternativnummer: USB-370510-20,USB-370510-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Probable ligand-binding protein. Recombinant protein corresponding to aa13-182 from blattella germanica Allergen Bla g 4, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.8kD Amino Acid Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.8
UniProt: P54962
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.