Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)

Produktübersicht

• Artikelname: Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)
• Artikelnummer: USB-370516
• Hersteller Artikelnummer: 370516
• Alternativnummer: USB-370516-50,USB-370516-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May be involved in the regulation of dopamine release and transport. Source: Recombinant protein corresponding to aa1-140 from rat Snca, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.9kD Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.9
• UniProt: P37377
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.