AmpC, Recombinant, Pseudomonas Aeruginosa, aa27-397, His-SUMO-Tag (Beta-Lactamase)

Artikelnummer: USB-370518
Artikelname: AmpC, Recombinant, Pseudomonas Aeruginosa, aa27-397, His-SUMO-Tag (Beta-Lactamase)
Artikelnummer: USB-370518
Hersteller Artikelnummer: 370518
Alternativnummer: USB-370518-20,USB-370518-100,USB-370518-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Beta-lactamases (such a penicillinase) are enzymes produced by some bacteria and are responsible for their resistance to beta-lactam antibiotics like penicillins, cephamycins, and carbapenems (ertapenem). (Cephalosporins are relatively resistant to beta-lactamase.) These antibiotics have a common element in their molecular structure: a four-atom ring known as a beta-lactam. The lactamase enzyme breaks that ring open, deactivating the molecules antibacterial properties. Recombinant protein corresponding to aa27-397 from Pseudomonas aeruginosa ampC, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P24735 Molecular Weight: ~56.65kD Amino Acid Sequence: GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with 0.1M NaHCO3,. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 56.65
UniProt: P24735
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with 0.1M NaHCO3 to a concnetration of 0.1-1.0mg/ml.