Amyloid Protein A, Recombinant, Feline, aa1-90, His-B2M-Tag (SAA1)

Artikelnummer: USB-370519
Artikelname: Amyloid Protein A, Recombinant, Feline, aa1-90, His-B2M-Tag (SAA1)
Artikelnummer: USB-370519
Hersteller Artikelnummer: 370519
Alternativnummer: USB-370519-20,USB-370519-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Partial recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.1kD Amino Acid Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.1
UniProt: P19707
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.