Apolipoprotein E, Recombinant, Mouse, aa19-311, His-Tag (ApoE)

Produktübersicht

• Artikelname: Apolipoprotein E, Recombinant, Mouse, aa19-311, His-Tag (ApoE)
• Artikelnummer: USB-370526
• Hersteller Artikelnummer: 370526
• Alternativnummer: USB-370526-20,USB-370526-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnants) of hepatic tissues. Recombinant protein corresponding to aa19-311 from mouse Apoe, fused to 6xHis-Tag at N-terminal, expressed in yeast. Molecular Weight: ~35.9kD Amino Acid Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 35.9
• UniProt: P08226
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.