Aquaporin-4, Recombinant, Human, aa253-323, His-SUMO-Tag (AQP4)

Artikelnummer: USB-370531
Artikelname: Aquaporin-4, Recombinant, Human, aa253-323, His-SUMO-Tag (AQP4)
Artikelnummer: USB-370531
Hersteller Artikelnummer: 370531
Alternativnummer: USB-370531-20,USB-370531-100,USB-370531-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system. Source: Partial recombinant protein corresponding to aa253-323 from human AQP4, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.98kD Amino Acid Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.98
UniProt: P55087
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.