Aspergillopepsin-2, Recombinant, Aspergillus Niger, aa60-98, His-SUMO-Tag (Proctase A, Aspergillopepsin II)

Artikelnummer: USB-370534
Artikelname: Aspergillopepsin-2, Recombinant, Aspergillus Niger, aa60-98, His-SUMO-Tag (Proctase A, Aspergillopepsin II)
Artikelnummer: USB-370534
Hersteller Artikelnummer: 370534
Alternativnummer: USB-370534-20,USB-370534-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Preferential cleavage in B chain of insulin: 3-Asn-|-Gln-4, 13-Gly-|-Ala-14, and 26-Tyr-|-Thr-27. Partial recombinant protein corresponding to aa60-98 from Aspergillus niger Aspergillopepsin-2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.9kD Amino Acid Sequence: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.9
UniProt: P24665
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.