Beta-mammal Toxin Css4, Recombinant, Centruroides Suffusus Suffusu, aa20-85, His-SUMO-Tag

Artikelnummer: USB-370542
Artikelname: Beta-mammal Toxin Css4, Recombinant, Centruroides Suffusus Suffusu, aa20-85, His-SUMO-Tag
Artikelnummer: USB-370542
Hersteller Artikelnummer: 370542
Alternativnummer: USB-370542-20,USB-370542-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals. Source: Partial recombinant protein corresponding to aa20-85 from centruroides suffusus suffusus Beta-mammal toxin Css4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.61kD Amino Acid Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.61
UniProt: P60266
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.