Catechol 1,2-Dioxygenase, Recombinant, Acinetobacter Baylyi, aa1-311, His-SUMO-Tag (catA, 1,2-CTD)

Produktübersicht

• Artikelname: Catechol 1,2-Dioxygenase, Recombinant, Acinetobacter Baylyi, aa1-311, His-SUMO-Tag (catA, 1,2-CTD)
• Artikelnummer: USB-370552
• Hersteller Artikelnummer: 370552
• Alternativnummer: USB-370552-20,USB-370552-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Catechol + O2 = cis,cis-muconate. Source: Recombinant full length protein corresponding to aa1-311 from Acinetobacter baylyi CatA, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.3kD Amino Acid Sequence: MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 50.3
• UniProt: P07773
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.