CdtB, Recombinant, E. coli, aa19-269, His-SUMO-Tag, Myc-Tag (Cytolethal Distending Toxin Subunit B)

Artikelnummer: USB-370556
Artikelname: CdtB, Recombinant, E. coli, aa19-269, His-SUMO-Tag, Myc-Tag (Cytolethal Distending Toxin Subunit B)
Artikelnummer: USB-370556
Hersteller Artikelnummer: 370556
Alternativnummer: USB-370556-20,USB-370556-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement. Source: Recombinant protein corresponding to aa19-269 from E. coli cdtB, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~47.4kD Amino Acid Sequence: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.4
UniProt: Q46669
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.