CS6 Fimbrial Subunit B, Recombinant, E. coli, aa22-167, His-SUMO-Tag (CssB)

Produktübersicht

• Artikelname: CS6 Fimbrial Subunit B, Recombinant, E. coli, aa22-167, His-SUMO-Tag (CssB)
• Artikelnummer: USB-370573
• Hersteller Artikelnummer: 370573
• Alternativnummer: USB-370573-20,USB-370573-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa22-167 from Escherichia coli cssB, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.9kD Amino Acid Sequence: GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 31.9
• UniProt: P53510
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.