Desmoplakin, Recombinant, Human, aa78-300, His-SUMO-Tag (DSP)

Artikelnummer: USB-370588
Artikelname: Desmoplakin, Recombinant, Human, aa78-300, His-SUMO-Tag (DSP)
Artikelnummer: USB-370588
Hersteller Artikelnummer: 370588
Alternativnummer: USB-370588-20,USB-370588-100,USB-370588-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes. Source: Partial recombinant protein corresponding to aa78-300 from human DSP, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD Amino Acid Sequence: CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42
UniProt: P15924
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.