Ubiquitin-like protein FUBI, Recombinant, Human, aa1-133, GST-Tag (FAU)

Produktübersicht

• Artikelname: Ubiquitin-like protein FUBI, Recombinant, Human, aa1-133, GST-Tag (FAU)
• Artikelnummer: USB-370606
• Hersteller Artikelnummer: 370606
• Alternativnummer: USB-370606-20,USB-370606-100,USB-370606-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

FUBI is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Recombinant protein corresponding to aa1-133 from full length human FAU, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.4kD Amino Acid Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.4
• UniProt: P35544
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.