Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression. Recombinant protein corresponding to aa26-218 from mouse FGF-15, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: O35622. Molecular Weight: ~38.5kD Amino Acid Sequence: RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
