FimA, Recombinant, E. coli, aa24-182, His-SUMO-Tag (Type-1 Fimbrial Protein, A Chain)

Produktübersicht

• Artikelname: FimA, Recombinant, E. coli, aa24-182, His-SUMO-Tag (Type-1 Fimbrial Protein, A Chain)
• Artikelnummer: USB-370614
• Hersteller Artikelnummer: 370614
• Alternativnummer: USB-370614-20,USB-370614-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. Source: Recombinant protein corresponding to aa24-182 from Escherichia coli flmA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 31.8
• UniProt: P04128
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.