Forkhead Box Protein M1, Recombinant, Human, aa235-327, His-SUMO-Tag, Myc-Tag

Produktübersicht

• Artikelname: Forkhead Box Protein M1, Recombinant, Human, aa235-327, His-SUMO-Tag, Myc-Tag
• Artikelnummer: USB-370615
• Hersteller Artikelnummer: 370615
• Alternativnummer: USB-370615-20,USB-370615-100,USB-370615-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. Partial ecombinant protein corresponding to aa235-327 from human Forkhead box protein M1, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~31.2kD AA Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 31.2
• UniProt: Q08050
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.