GFER, Recombinant, Rat, aa1-198, His-SUMO-Tag (FAD-linked Sulfhydryl Oxidase ALR)

Artikelnummer: USB-370621
Artikelname: GFER, Recombinant, Rat, aa1-198, His-SUMO-Tag (FAD-linked Sulfhydryl Oxidase ALR)
Artikelnummer: USB-370621
Hersteller Artikelnummer: 370621
Alternativnummer: USB-370621-20,USB-370621-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. Source: Recombinant protein corresponding to aa1-198 from full length rat GFER, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.8kD Amino Acid Sequence: MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.8
UniProt: Q63042
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.