HLA Class II Histocompatibility, DRB1-1 beta Chain, Recombinant, Human, aa30-227, His-SUMO-Tag, Myc-Tag (HLA-DRB1)

Artikelnummer: USB-370645
Artikelname: HLA Class II Histocompatibility, DRB1-1 beta Chain, Recombinant, Human, aa30-227, His-SUMO-Tag, Myc-Tag (HLA-DRB1)
Artikelnummer: USB-370645
Hersteller Artikelnummer: 370645
Alternativnummer: USB-370645-20,USB-370645-100,USB-370645-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Partial recombinant protein corresponding to aa30-227 from human HLA-DRB1, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~42.9kD Amino Acid Sequence: GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.9
UniProt: P04229
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.