Interleukin-18, Recombinant, Canine, aa37-193, His-Tag (IL18)

Artikelnummer: USB-370664
Artikelname: Interleukin-18, Recombinant, Canine, aa37-193, His-Tag (IL18)
Artikelnummer: USB-370664
Hersteller Artikelnummer: 370664
Alternativnummer: USB-370664-20,USB-370664-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells. Source: Recombinant protein corresponding to aa37-193 from canine IL18, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.1kD Amino Acid Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.1
UniProt: Q9XSR0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.