LDHA, Recombinant, Human, aa5-323, His-Tag (L-Lactate Dehydrogenase A Chain)

Artikelnummer: USB-370677
Artikelname: LDHA, Recombinant, Human, aa5-323, His-Tag (L-Lactate Dehydrogenase A Chain)
Artikelnummer: USB-370677
Hersteller Artikelnummer: 370677
Alternativnummer: USB-370677-20,USB-370677-100,USB-370677-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Defects in LDHA are the cause of glycogen storage disease type 11 (GSD11) [MIM:612933]. A metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue. Recombinant protein corresponding to aa5-323 from human LDHA, fused to 6X His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD Amino Acid Sequence: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.2
UniProt: P00338
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid Tris, 50% glycerol.