Lysyl Endopeptidase, Recombinant, Pseudomonas Aeruginosa, aa212-462, His-Tag (PrpL)

Artikelnummer: USB-370681
Artikelname: Lysyl Endopeptidase, Recombinant, Pseudomonas Aeruginosa, aa212-462, His-Tag (PrpL)
Artikelnummer: USB-370681
Hersteller Artikelnummer: 370681
Alternativnummer: USB-370681-20,USB-370681-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Lysine-specific endoprotease. Involved in corneal virulence. Source: Recombinant protein corresponding to aa212-462 from pseudomonas aeruginosa Lysyl Endopeptidase fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.4kD Amino Acid Sequence: AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.4
UniProt: Q9HWK6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.