Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag

Artikelnummer: USB-370683
Artikelname: Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag
Artikelnummer: USB-370683
Hersteller Artikelnummer: 370683
Alternativnummer: USB-370683-20,USB-370683-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Causes an allergic reaction in human. Potent allergen responsible for about 80% of anti-horse IgE antibody response in patients who are chronically exposed to horse allergens. Source: Recombinant protein corresponding to aa16-187 from equine Major allergen Equ c 1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.1kD Amino Acid Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.1
UniProt: Q95182
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.