Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag

Produktübersicht

• Artikelname: Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag
• Artikelnummer: USB-370683
• Hersteller Artikelnummer: 370683
• Alternativnummer: USB-370683-20,USB-370683-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Causes an allergic reaction in human. Potent allergen responsible for about 80% of anti-horse IgE antibody response in patients who are chronically exposed to horse allergens. Source: Recombinant protein corresponding to aa16-187 from equine Major allergen Equ c 1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.1kD Amino Acid Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 22.1
• UniProt: Q95182
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.