Major Pollen Allergen Car b 1 isoforms 1A and 1B, Recombinant, Carpinus Betulus, aa2-160, His-Tag

Produktübersicht

• Artikelname: Major Pollen Allergen Car b 1 isoforms 1A and 1B, Recombinant, Carpinus Betulus, aa2-160, His-Tag
• Artikelnummer: USB-370686
• Hersteller Artikelnummer: 370686
• Alternativnummer: USB-370686-20,USB-370686-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam. Source: Recombinant protein corresponding to aa2-160 from Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.3kD Amino Acid Sequence: GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 21.3
• UniProt: P38949
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.