MYBPC3, Recombinant, Human, aa1-328, His-SUMO-Tag (Myosin-binding Protein C, Cardiac-type)

Produktübersicht

• Artikelname: MYBPC3, Recombinant, Human, aa1-328, His-SUMO-Tag (Myosin-binding Protein C, Cardiac-type)
• Artikelnummer: USB-370702
• Hersteller Artikelnummer: 370702
• Alternativnummer: USB-370702-20,USB-370702-100,USB-370702-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Source: Partial recombinant protein corresponding to aa1-328 from human MYBPC3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.8kD Amino Acid Sequence: MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 50.8
• UniProt: Q14896
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.