NfuA, Recombinant, Vibrio Vulnificus, aa1-194, His-Tag (Fe/S Biogenesis Protein NfuA)

Produktübersicht

• Artikelname: NfuA, Recombinant, Vibrio Vulnificus, aa1-194, His-Tag (Fe/S Biogenesis Protein NfuA)
• Artikelnummer: USB-370709
• Hersteller Artikelnummer: 370709
• Alternativnummer: USB-370709-20,USB-370709-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. Source: Recombinant full length protein corresponding to aa1-194 from Vibrio vulnificus NfuA, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~25.44kD Amino Acid Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 25.44
• UniProt: Q8DDU2
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.