OSM34, Recombinant, Arabidopsis Thaliana, aa23-244, His-SUMO-Tag, Myc-Tag (Osmotin-like Protein OSM34)

Produktübersicht

• Artikelname: OSM34, Recombinant, Arabidopsis Thaliana, aa23-244, His-SUMO-Tag, Myc-Tag (Osmotin-like Protein OSM34)
• Artikelnummer: USB-370726
• Hersteller Artikelnummer: 370726
• Alternativnummer: USB-370726-20,USB-370726-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa23-244 from arabidopsis thaliana OSM34, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~44.42kD Amino Acid Sequence: ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 44.42
• UniProt: P50700
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.