Pertactin Autotransporter, Recombinant, Bordetella Pertussis, aa632-910, His-Tag (Prn)

Artikelnummer: USB-370744
Artikelname: Pertactin Autotransporter, Recombinant, Bordetella Pertussis, aa632-910, His-Tag (Prn)
Artikelnummer: USB-370744
Hersteller Artikelnummer: 370744
Alternativnummer: USB-370744-20,USB-370744-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Agglutinogen that binds to eukaryotic cells, a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough. Source: Partial recombinant protein corresponding to aa632-910 from Bordetella pertussis Prn, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.8kD Amino Acid Sequence: ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 45.8
UniProt: P14283
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.