Plasma Kallikrein, Recombinant, Rat, aa391-638, His-Tag (Klkb1)

Artikelnummer: USB-370746
Artikelname: Plasma Kallikrein, Recombinant, Rat, aa391-638, His-Tag (Klkb1)
Artikelnummer: USB-370746
Hersteller Artikelnummer: 370746
Alternativnummer: USB-370746-20,USB-370746-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. Partial recombinant protein corresponding to aa391-638 from rat Klkb1, fused to 6X His-Tag at N-terminal, expressed in yeast. Uniprot Number: P14272 Molecular Weight: ~29.8kD Amino Acid Sequence: IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.8
UniProt: P14272
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.