PLXNA1, Recombinant, Human, aa986-1152, His-Tag (Plexin-A1)

Artikelnummer: USB-370749
Artikelname: PLXNA1, Recombinant, Human, aa986-1152, His-Tag (Plexin-A1)
Artikelnummer: USB-370749
Hersteller Artikelnummer: 370749
Alternativnummer: USB-370749-20,USB-370749-100,USB-370749-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Coreceptor for SA3A, SA3C, SA3F and SA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm. Source: Partial recombinant protein corresponding to aa986-1152 from human PLXNA1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.4kD Amino Acid Sequence: LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.4
UniProt: Q9UIW2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol