Protein Wnt-8b, Recombinant, Mouse, aa22-350, His-SUMO-Tag, Myc-Tag (Wnt8b)

Produktübersicht

• Artikelname: Protein Wnt-8b, Recombinant, Mouse, aa22-350, His-SUMO-Tag, Myc-Tag (Wnt8b)
• Artikelnummer: USB-370763
• Hersteller Artikelnummer: 370763
• Alternativnummer: USB-370763-20,USB-370763-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. Source: Recombinant protein corresponding to aa22-350 from mouse Wnt8b, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~56.2kD Amino Acid Sequence: WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 56.2
• UniProt: Q9WUD6
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.