Selenoprotein M, Recombinant, Human, aa24-145, His-Tag (SELM)

Produktübersicht

• Artikelname: Selenoprotein M, Recombinant, Human, aa24-145, His-Tag (SELM)
• Artikelnummer: USB-370791
• Hersteller Artikelnummer: 370791
• Alternativnummer: USB-370791-20,USB-370791-100,USB-370791-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. Recombinant protein corresponding to aa24-145 from human Selenoprotein, fused to 6X His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~17.54kD Amino Acid Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 17.54
• UniProt: Q8WWX9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.