Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Source: Recombinant protein corresponding to aa21-147 from mouse Transthyretin, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD Amino Acid Sequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
