30S Ribosomal Protein S2, Recombinant, E. coli, aa1-241, His-SUMO-Tag (RpsB)

Produktübersicht

• Artikelname: 30S Ribosomal Protein S2, Recombinant, E. coli, aa1-241, His-SUMO-Tag (RpsB)
• Artikelnummer: USB-372091
• Hersteller Artikelnummer: 372091
• Alternativnummer: USB-372091-20,USB-372091-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-241 from E. coli 30S Ribosomal Protein S2, fused to His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~46.7kD Amino Acid Sequence: MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 46.7
• UniProt: Q1RG21
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.