AAC, Recombinant, Actinoplanes Utahensis, aa35-214, His-SUMO-Tag (Aculeacin-A acylase)

Artikelnummer: USB-372097
Artikelname: AAC, Recombinant, Actinoplanes Utahensis, aa35-214, His-SUMO-Tag (Aculeacin-A acylase)
Artikelnummer: USB-372097
Hersteller Artikelnummer: 372097
Alternativnummer: USB-372097-20,USB-372097-100,USB-372097-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid. Source: Recombinant protein corresponding to aa35-214 from actinoplanes utahensis Aculeacin-A Acylase, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.1kD Amino Acid Sequence: GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.1
UniProt: P29958
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.