ABHD14B, Recombinant, Human, aa2-210, His-SUMO-Tag (Abhydrolase Domain-containing Protein 14B)

Produktübersicht

• Artikelname: ABHD14B, Recombinant, Human, aa2-210, His-SUMO-Tag (Abhydrolase Domain-containing Protein 14B)
• Artikelnummer: USB-372109
• Hersteller Artikelnummer: 372109
• Alternativnummer: USB-372109-20,USB-372109-100,USB-372109-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa2-210 from human ABHD14B, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.2kD Amino Acid Sequence: AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 38.2
• UniProt: Q96IU4
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.