ACAA1, Recombinant, Human, aa27-331, His-SUMO-Tag (3-ketoacyl-CoA Thiolase, Peroxisomal)

Artikelnummer: USB-372114
Artikelname: ACAA1, Recombinant, Human, aa27-331, His-SUMO-Tag (3-ketoacyl-CoA Thiolase, Peroxisomal)
Artikelnummer: USB-372114
Hersteller Artikelnummer: 372114
Alternativnummer: USB-372114-20,USB-372114-100,USB-372114-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa27-331 from human ACAA1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.82kD Amino Acid Sequence: LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.82
UniProt: P09110
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.