Alba, Recombinant, Pyrococcus furiosus, aa1-93, His-SUMO-Tag (DNA/RNA-binding Protein albA)

Produktübersicht

• Artikelname: Alba, Recombinant, Pyrococcus furiosus, aa1-93, His-SUMO-Tag (DNA/RNA-binding Protein albA)
• Artikelnummer: USB-372218
• Hersteller Artikelnummer: 372218
• Alternativnummer: USB-372218-20,USB-372218-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes. Source: Recombinant protein corresponding to aa1-93 from pyrococcus furiosus albA, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~26.4kD Amino Acid Sequence: MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.4
• UniProt: Q8TZV1
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.