ALKBH3, Recombinant, Human, aa1-170, His-SUMO-Tag (Alpha-ketoglutarate-dependent Dioxygenase alkB Homolog 3)

Artikelnummer: USB-372230
Artikelname: ALKBH3, Recombinant, Human, aa1-170, His-SUMO-Tag (Alpha-ketoglutarate-dependent Dioxygenase alkB Homolog 3)
Artikelnummer: USB-372230
Hersteller Artikelnummer: 372230
Alternativnummer: USB-372230-20,USB-372230-100,USB-372230-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Dioxygenase that repairs alkylated DNA containing 1-methyladenine (1meA) and 3-methylcytosine (3meC) by oxidative dethylation. Has a strong preference for single-stranded DNA. Able to process alkylated 3mC within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron. Source: Recombinant protein corresponding to aa1-170 from human ALKBH3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.3kD Amino Acid Sequence: MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIEEGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDSILQLTFKKSAPVSGTATAPQSCWYERPSPPHIPGPAILTRTRLWAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.3
UniProt: Q96Q83
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.