ALTA1, Recombinant, Alternaria Alternata, aa19-157, His-Tag (Major Allergen Alt a 1)

Produktübersicht

• Artikelname: ALTA1, Recombinant, Alternaria Alternata, aa19-157, His-Tag (Major Allergen Alt a 1)
• Artikelnummer: USB-372236
• Hersteller Artikelnummer: 372236
• Alternativnummer: USB-372236-20,USB-372236-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Recombinant protein corresponding to aa19-157 from alternaria alternata ALTA1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.2kD Amino Acid Sequence: APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 19.2
• UniProt: P79085
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.