Anti-Muellerian Hormone, Recombinant, Mouse, aa450-552 (Muellerian-inhibiting Factor, Amh)

Artikelnummer: USB-372244
Artikelname: Anti-Muellerian Hormone, Recombinant, Mouse, aa450-552 (Muellerian-inhibiting Factor, Amh)
Artikelnummer: USB-372244
Hersteller Artikelnummer: 372244
Alternativnummer: USB-372244-20,USB-372244-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. Partial recombinant protein corresponding to aa450-552 from mouse Anti-Muellerian Hormone, expressed in E. coli. Molecular Weight: ~11.3kD Amino Acid Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.3
UniProt: P27106
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.