Apoc3I, Recombinant, Rat, aa21-101, His-Tag (Apolipoprotein C-III)

Produktübersicht

• Artikelname: Apoc3I, Recombinant, Rat, aa21-101, His-Tag (Apolipoprotein C-III)
• Artikelnummer: USB-372302
• Hersteller Artikelnummer: 372302
• Alternativnummer: USB-372302-20, USB-372302-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion, Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. Source: Recombinant protein corresponding to aa21-101 from rat Apolipoprotein C-III, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11kD Amino Acid Sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 11
• UniProt: P06759
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.