ARF5, Recombinant, Human, aa2-180, GST-Tag (ADP-ribosylation Factor 5)

Artikelnummer: USB-372316
Artikelname: ARF5, Recombinant, Human, aa2-180, GST-Tag (ADP-ribosylation Factor 5)
Artikelnummer: USB-372316
Hersteller Artikelnummer: 372316
Alternativnummer: USB-372316-20,USB-372316-100,USB-372316-1
Hersteller: US Biological
Kategorie: Molekularbiologie
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Source: Recombinant protein corresponding to aa2-180 from human ARF5, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~47.4kD Amino Acid Sequence: GLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.4
UniProt: P84085
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.