Arginase-1, Recombinant, Mouse, aa1-323, His-SUMO-Tag (Arg1, Arginase 1, Liver-type Arginase, Type I Arginase)

Produktübersicht

• Artikelname: Arginase-1, Recombinant, Mouse, aa1-323, His-SUMO-Tag (Arg1, Arginase 1, Liver-type Arginase, Type I Arginase)
• Artikelnummer: USB-372320
• Hersteller Artikelnummer: 372320
• Alternativnummer: USB-372320-20,USB-372320-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively, the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys. Source: Recombinant protein corresponding to aa1-323 from full length mouse Arg1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.8kD Amino Acid Sequence: MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 50.8
• UniProt: Q61176
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.