Arginine Kinase, Recombinant, Penaeus Monodon, aa2-356, His-SUMO-Tag (AK)

Artikelnummer: USB-372325
Artikelname: Arginine Kinase, Recombinant, Penaeus Monodon, aa2-356, His-SUMO-Tag (AK)
Artikelnummer: USB-372325
Hersteller Artikelnummer: 372325
Alternativnummer: USB-372325-20,USB-372325-200
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa2-356 from penaeus monodon Arginine Kinase, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56kD Amino Acid Sequence: ADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 56
UniProt: C7E3T4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.