AroD, Recombinant, Salmonella typhi, aa1-252, His-SUMO-Tag (3-Dehydroquinate Dehydratase)

Artikelnummer: USB-372337
Artikelname: AroD, Recombinant, Salmonella typhi, aa1-252, His-SUMO-Tag (3-Dehydroquinate Dehydratase)
Artikelnummer: USB-372337
Hersteller Artikelnummer: 372337
Alternativnummer: USB-372337-20,USB-372337-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. Source: Recombinant protein corresponding to aa1-252 from salmonella typhi 3-Dehydroquinate Dehydratase, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.6kD Amino Acid Sequence: MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 43.6
UniProt: P24670
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.