ASCC3, Recombinant, Human, aa1-111, GST-Tag (Activating Signal Cointegrator 1 Complex Subunit 3)

Artikelnummer: USB-372351
Artikelname: ASCC3, Recombinant, Human, aa1-111, GST-Tag (Activating Signal Cointegrator 1 Complex Subunit 3)
Artikelnummer: USB-372351
Hersteller Artikelnummer: 372351
Alternativnummer: USB-372351-20,USB-372351-100,USB-372351-1
Hersteller: US Biological
Kategorie: Molekularbiologie
3-5 DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation. Recombinant protein corresponding to aa1-111 from human ASCC3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.0kD AA Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40
UniProt: Q8N3C0
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.