ATG8, Recombinant, Candida glabrata, aa1-116, His-Tag (Autophagy-related Protein 8)

Artikelnummer: USB-372369
Artikelname: ATG8, Recombinant, Candida glabrata, aa1-116, His-Tag (Autophagy-related Protein 8)
Artikelnummer: USB-372369
Hersteller Artikelnummer: 372369
Alternativnummer: USB-372369-20,USB-372369-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hifusion, leading to expansion of the autophagosomal membrane during autophagy. Source: Recombinant full length protein corresponding to aa1-116 from candida glabrata ATG8, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD Amino Acid Sequence: MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.5
UniProt: Q6FXR8
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.