Avpr1a, Recombinant, Rat, aa7-52, GST-Tag (Vasopressin V1a Receptor)

Produktübersicht

• Artikelname: Avpr1a, Recombinant, Rat, aa7-52, GST-Tag (Vasopressin V1a Receptor)
• Artikelnummer: USB-372396
• Hersteller Artikelnummer: 372396
• Alternativnummer: USB-372396-20,USB-372396-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation. Source: Recombinant protein corresponding to aa7-52 from rat Avpr1a, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD Amino Acid Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.3
• UniProt: P30560
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.