Avpr1b, Recombinant, Rat, aa343-425, His-Tag (Vasopressin V1b Receptor)

Produktübersicht

• Artikelname: Avpr1b, Recombinant, Rat, aa343-425, His-Tag (Vasopressin V1b Receptor)
• Artikelnummer: USB-372397
• Hersteller Artikelnummer: 372397
• Alternativnummer: USB-372397-20,USB-372397-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Source: Recombinant protein corresponding to aa343-425 from rat Avpr1b, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.1kD Amino Acid Sequence: NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 13.1
• UniProt: P48974
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.