BEND3, Recombinant, Human, aa328-461, His-Tag (BEN Domain-containing Protein 3)

Artikelnummer: USB-372436
Artikelname: BEND3, Recombinant, Human, aa328-461, His-Tag (BEN Domain-containing Protein 3)
Artikelnummer: USB-372436
Hersteller Artikelnummer: 372436
Alternativnummer: USB-372436-20,USB-372436-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa328-461 from human BEND3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.5kD Amino Acid Sequence: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.5
UniProt: Q5T5X7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.